SCOPe 2.07: Domain d2v81a1: 2v81 A:1-205

Lineage for d2v81a1 (2v81 A:1-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225333] (3 PDB entries)

8. Domain d2v81a1: 2v81 A:1-205 [206269]
   Other proteins in same PDB: d2v81a2
   automated match to d1vlwc_

Details for d2v81a1

PDB Entry: 2v81, 2.4 Å

PDB Description: native kdpgal structure

PDB Compounds: (A:) 2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d2v81a1:

Sequence; same for both SEQRES and ATOM records:

>d2v81a1 c.1.10.0 (A:1-205) automated matches {Escherichia coli [TaxId: 562]}
mqwqtklpliailrgitpdealahvgavidagfdaveiplnspqweqsipaivdaygdka
ligagtvlkpeqvdalarmgcqlivtpnihsevirravgygmtvcpgcatateaftalea
gaqalkifpssafgpqyikalkavlpsdiavfavggvtpenlaqwidagcagaglgsdly
ragqsvertaqqaaafvkayreavq

Timeline for d2v81a1:

• d2v81a1 first appeared in SCOPe 2.03, called d2v81a_
  
• d2v81a1 appears in SCOPe 2.06
  
• d2v81a1 appears in the current release, SCOPe 2.08