Lineage for d2v6ba2 (2v6b A:165-324)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680925Species Deinococcus radiodurans [TaxId:1299] [225330] (1 PDB entry)
  8. 1680926Domain d2v6ba2: 2v6b A:165-324 [206240]
    Other proteins in same PDB: d2v6ba1, d2v6bb1, d2v6bc1, d2v6bd1
    automated match to d1llda2

Details for d2v6ba2

PDB Entry: 2v6b (more details), 2.5 Å

PDB Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6ba2:

Sequence, based on SEQRES records: (download)

>d2v6ba2 d.162.1.0 (A:165-324) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrnaaasiiegkratyygigaalariteavlrdrravltvsaptpeygv
slslprvvgrqgvlstlhpkltgdeqqkleqsagvlrg

Sequence, based on observed residues (ATOM records): (download)

>d2v6ba2 d.162.1.0 (A:165-324) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfmqaqnlpw
neqvrakidegtrntyygigaalariteavlrdrravltvsaptpeygvslslprvvgrq
gvlstlhpkltgdeqqkleqsagvlrg

SCOPe Domain Coordinates for d2v6ba2:

Click to download the PDB-style file with coordinates for d2v6ba2.
(The format of our PDB-style files is described here.)

Timeline for d2v6ba2: