Lineage for d2v59a3 (2v59 A:331-445)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2426885Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2426892Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2426895Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 2426924Domain d2v59a3: 2v59 A:331-445 [206219]
    Other proteins in same PDB: d2v59a1, d2v59a2, d2v59b1, d2v59b2
    automated match to d1dv1a1
    complexed with lzk

Details for d2v59a3

PDB Entry: 2v59 (more details), 2.4 Å

PDB Description: crystal structure of biotin carboxylase from e.coli in complex with potent inhibitor 2
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2v59a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v59a3 b.84.2.1 (A:331-445) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklg

SCOPe Domain Coordinates for d2v59a3:

Click to download the PDB-style file with coordinates for d2v59a3.
(The format of our PDB-style files is described here.)

Timeline for d2v59a3: