Lineage for d2v4la2 (2v4l A:357-522)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038040Family b.7.1.1: PLC-like (P variant) [49563] (12 protein domains)
  6. 2038063Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2038064Species Human (Homo sapiens) [TaxId:9606] [49572] (61 PDB entries)
  8. 2038092Domain d2v4la2: 2v4l A:357-522 [206204]
    Other proteins in same PDB: d2v4la1, d2v4la3, d2v4la4
    automated match to d1e8ya2
    complexed with abj

Details for d2v4la2

PDB Entry: 2v4l (more details), 2.5 Å

PDB Description: complex of human phosphoinositide 3-kinase catalytic subunit gamma (p110 gamma) with PIK-284
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2v4la2:

Sequence, based on SEQRES records: (download)

>d2v4la2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d2v4la2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsa
tnpdkensmsisilldn

SCOPe Domain Coordinates for d2v4la2:

Click to download the PDB-style file with coordinates for d2v4la2.
(The format of our PDB-style files is described here.)

Timeline for d2v4la2: