PDB entry 2v4l

View 2v4l on RCSB PDB site
Description: complex of human phosphoinositide 3-kinase catalytic subunit gamma (p110 gamma) with PIK-284
Class: transferase
Keywords: transferase, lipid kinase, phosphoinositide, pyrazolopyrimidine, s1, kinase, pik-284, 3-kinase, inhibitor, signaling
Deposited on 2008-09-25, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • conflict (316)
    Domains in SCOPe 2.07: d2v4la1, d2v4la2, d2v4la3, d2v4la4
  • Heterogens: ABJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v4lA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4lA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakqdfvlrvcg
    rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeewcdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycgrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisi
    lldnhpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfss
    vkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesleddd
    vlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfav
    ileaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlq
    nsqlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhg
    ddlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqst
    vgntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimit
    etgnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlli
    ilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl
    hlvlg