Lineage for d2rjtc1 (2rjt C:2-251)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2523963Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2523973Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries)
  8. 2523988Domain d2rjtc1: 2rjt C:2-251 [206143]
    automated match to d1ox0a1
    mutant

Details for d2rjtc1

PDB Entry: 2rjt (more details), 1.75 Å

PDB Description: crystal structure analysis of a surface entropy reduction mutant of s. pneumoniae fabf
PDB Compounds: (C:) Beta-ketoacyl-ACP synthase II

SCOPe Domain Sequences for d2rjtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjtc1 c.95.1.1 (C:2-251) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
slehaekrga

SCOPe Domain Coordinates for d2rjtc1:

Click to download the PDB-style file with coordinates for d2rjtc1.
(The format of our PDB-style files is described here.)

Timeline for d2rjtc1: