SCOPe 2.08: Domain d2r1xb1: 2r1x B:1-111

Lineage for d2r1xb1 (2r1x B:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d2r1xb1: 2r1x B:1-111 [205932]
   Other proteins in same PDB: d2r1xa1, d2r1xa2, d2r1xb2
   automated match to d3t65b1
   complexed with mg, zn

Details for d2r1xb1

PDB Entry: 2r1x, 1.6 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues

PDB Compounds: (B:) Fab, antibody fragment (IgG1k), heavy chain

SCOPe Domain Sequences for d2r1xb1:

Sequence; same for both SEQRES and ATOM records:

>d2r1xb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

Timeline for d2r1xb1:

• d2r1xb1 first appeared in SCOPe 2.03
  
• d2r1xb1 appears in SCOPe 2.07