Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries) |
Domain d2qted_: 2qte D: [205886] automated match to d2apva_ mutant |
PDB Entry: 2qte (more details), 1.9 Å
SCOPe Domain Sequences for d2qted_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qted_ b.1.1.0 (D:) automated matches {Ictalurus punctatus [TaxId: 7998]} ikelhvktvkrgenvtmecsmskvtnkdnlawyrqsfgkvpqyfvryyssnsgykfaegf kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqf
Timeline for d2qted_: