Lineage for d2qted_ (2qte D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369675Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 2369689Domain d2qted_: 2qte D: [205886]
    automated match to d2apva_
    mutant

Details for d2qted_

PDB Entry: 2qte (more details), 1.9 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment mutant n30d
PDB Compounds: (D:) Novel immune-type receptor 11

SCOPe Domain Sequences for d2qted_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qted_ b.1.1.0 (D:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnkdnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqf

SCOPe Domain Coordinates for d2qted_:

Click to download the PDB-style file with coordinates for d2qted_.
(The format of our PDB-style files is described here.)

Timeline for d2qted_: