Lineage for d2qlpb_ (2qlp B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427431Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 2427467Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)
  8. 2427471Domain d2qlpb_: 2qlp B: [205842]
    automated match to d2v9xj_
    complexed with 1pe

Details for d2qlpb_

PDB Entry: 2qlp (more details), 2.47 Å

PDB Description: Bifunctional dCTP deaminase:dUTPase from Mycobacterium tuberculosis, apo form
PDB Compounds: (B:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qlpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlpb_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspse

SCOPe Domain Coordinates for d2qlpb_:

Click to download the PDB-style file with coordinates for d2qlpb_.
(The format of our PDB-style files is described here.)

Timeline for d2qlpb_: