Lineage for d2qkna1 (2qkn A:33-245)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675950Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 1675951Protein automated matches [191143] (7 species)
    not a true protein
  7. 1675956Species Maize (Zea mays) [TaxId:4577] [225479] (10 PDB entries)
  8. 1675965Domain d2qkna1: 2qkn A:33-245 [205835]
    Other proteins in same PDB: d2qkna2
    automated match to d1w1oa2
    complexed with 245, fad, gol, nag

Details for d2qkna1

PDB Entry: 2qkn (more details), 2.15 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase complexed with phenylurea inhibitor cppu
PDB Compounds: (A:) cytokinin dehydrogenase 1

SCOPe Domain Sequences for d2qkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkna1 d.145.1.0 (A:33-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
pwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanstp
gwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwid
vlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvt
cskqlnadlfdavlgglgqfgvitrariavepa

SCOPe Domain Coordinates for d2qkna1:

Click to download the PDB-style file with coordinates for d2qkna1.
(The format of our PDB-style files is described here.)

Timeline for d2qkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkna2