Lineage for d2q2ga2 (2q2g A:87-179)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527427Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 1527428Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) (S)
  5. 1527442Family b.4.1.0: automated matches [227209] (1 protein)
    not a true family
  6. 1527443Protein automated matches [226943] (2 species)
    not a true protein
  7. 1527444Species Cryptosporidium parvum [TaxId:353152] [225279] (1 PDB entry)
  8. 1527446Domain d2q2ga2: 2q2g A:87-179 [205731]
    automated match to d1c3ga2
    complexed with so4

Details for d2q2ga2

PDB Entry: 2q2g (more details), 1.9 Å

PDB Description: Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800
PDB Compounds: (A:) Heat shock 40 kDa protein, putative (fragment)

SCOPe Domain Sequences for d2q2ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ga2 b.4.1.0 (A:87-179) automated matches {Cryptosporidium parvum [TaxId: 353152]}
rftrddchlimkvtiplvraltgftcpvttldnrnlqipikeivnpktrkivpnegmpik
nqpgqkgdlilefdicfpksltpeqkklikeal

SCOPe Domain Coordinates for d2q2ga2:

Click to download the PDB-style file with coordinates for d2q2ga2.
(The format of our PDB-style files is described here.)

Timeline for d2q2ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q2ga1