Lineage for d2pzhd_ (2pzh D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646749Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1646750Protein automated matches [190143] (26 species)
    not a true protein
  7. 1646803Species Helicobacter pylori [TaxId:85962] [225438] (1 PDB entry)
  8. 1646807Domain d2pzhd_: 2pzh D: [205702]
    automated match to d1s5ug_

Details for d2pzhd_

PDB Entry: 2pzh (more details), 1.7 Å

PDB Description: YbgC thioesterase (Hp0496) from Helicobacter pylori
PDB Compounds: (D:) Hypothetical protein HP_0496

SCOPe Domain Sequences for d2pzhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzhd_ d.38.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
hmrcrvyyedtdsegvvyhanylkycerarsefffkqnvlpeneegvfvirsikadfftp
aslgqvleirtqikelrkvfvvlfqeiyciqnaslepmkpfkvfaseikfgfvnrstysp
iaipklfkellna

SCOPe Domain Coordinates for d2pzhd_:

Click to download the PDB-style file with coordinates for d2pzhd_.
(The format of our PDB-style files is described here.)

Timeline for d2pzhd_: