Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (18 species) not a true protein |
Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries) |
Domain d2pwfd2: 2pwf D:479-557 [205679] Other proteins in same PDB: d2pwfa1, d2pwfb1, d2pwfc1, d2pwfd1 automated match to d1m53a1 complexed with bgc, ca; mutant |
PDB Entry: 2pwf (more details), 1.8 Å
SCOPe Domain Sequences for d2pwfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pwfd2 b.71.1.0 (D:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]} gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa agaaslelqpwqsgiykvk
Timeline for d2pwfd2: