| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class beta GST [81368] (4 species) |
| Species Ochrobactrum anthropi [TaxId:529] [225311] (2 PDB entries) |
| Domain d2pvqa1: 2pvq A:1-80 [205653] Other proteins in same PDB: d2pvqa2 automated match to d1f2ea2 complexed with gsh, so4; mutant |
PDB Entry: 2pvq (more details), 1.8 Å
SCOPe Domain Sequences for d2pvqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvqa1 c.47.1.5 (A:1-80) Class beta GST {Ochrobactrum anthropi [TaxId: 529]}
mklyykvgaaslaphiilseaglpyeleavdlkakktadggdyfavnprgavpalevkpg
tvitqnaailqyigdhsdva
Timeline for d2pvqa1: