Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (45 species) not a true protein |
Species Aspergillus oryzae [TaxId:510516] [225271] (1 PDB entry) |
Domain d2ps2a2: 2ps2 A:131-370 [205605] Other proteins in same PDB: d2ps2a1, d2ps2b1, d2ps2c1, d2ps2d1 automated match to d1jpma1 complexed with mg |
PDB Entry: 2ps2 (more details), 1.8 Å
SCOPe Domain Sequences for d2ps2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ps2a2 c.1.11.0 (A:131-370) automated matches {Aspergillus oryzae [TaxId: 510516]} rtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqpd effivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelatn emsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaivh laqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavasy
Timeline for d2ps2a2: