Lineage for d2ps2d1 (2ps2 D:3-130)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413023Species Aspergillus oryzae [TaxId:510516] [225270] (1 PDB entry)
  8. 1413027Domain d2ps2d1: 2ps2 D:3-130 [205610]
    Other proteins in same PDB: d2ps2a2, d2ps2b2, d2ps2c2, d2ps2d2
    automated match to d1jpma2
    complexed with mg

Details for d2ps2d1

PDB Entry: 2ps2 (more details), 1.8 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae
PDB Compounds: (D:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2ps2d1:

Sequence, based on SEQRES records: (download)

>d2ps2d1 d.54.1.0 (D:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]}
dlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsnyia
shprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvgl
pvcellgg

Sequence, based on observed residues (ATOM records): (download)

>d2ps2d1 d.54.1.0 (D:3-130) automated matches {Aspergillus oryzae [TaxId: 510516]}
dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
g

SCOPe Domain Coordinates for d2ps2d1:

Click to download the PDB-style file with coordinates for d2ps2d1.
(The format of our PDB-style files is described here.)

Timeline for d2ps2d1: