SCOPe 2.03: Domain d2pr5a_: 2pr5 A:

Lineage for d2pr5a_ (2pr5 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (10 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225313] (2 PDB entries)

8. Domain d2pr5a_: 2pr5 A: [205596]
   automated match to d4hoia_
   complexed with acy, fmn, na

Details for d2pr5a_

PDB Entry: 2pr5, 1.45 Å

PDB Description: structural basis for light-dependent signaling in the dimeric lov photosensor ytva (dark structure)

PDB Compounds: (A:) Blue-light photoreceptor

SCOPe Domain Sequences for d2pr5a_:

Sequence; same for both SEQRES and ATOM records:

>d2pr5a_ d.110.3.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dhvrvgvvitdpalednpivyvnqgfvqmtgyeteeilgkncrflqgkhtdpaevdnirt
alqnkepvtvqiqnykkdgtmfwnelnidpmeiedktyfvgiqnditkqkeyeklledsl
teitals

Timeline for d2pr5a_:

• d2pr5a_ is new in SCOPe 2.03-stable
  
• d2pr5a_ appears in SCOPe 2.04
  
• d2pr5a_ appears in the current release, SCOPe 2.08