Lineage for d2pk3b_ (2pk3 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350016Species Aneurinibacillus thermoaerophilus [TaxId:143495] [225432] (1 PDB entry)
  8. 1350018Domain d2pk3b_: 2pk3 B: [205536]
    automated match to d1r66a_
    complexed with a2r, gdd

Details for d2pk3b_

PDB Entry: 2pk3 (more details), 1.82 Å

PDB Description: Crystal Structure of a GDP-4-keto-6-deoxy-D-mannose reductase
PDB Compounds: (B:) GDP-6-deoxy-D-lyxo-4-hexulose reductase

SCOPe Domain Sequences for d2pk3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk3b_ c.2.1.0 (B:) automated matches {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mralitgvagfvgkylanhlteqnvevfgtsrnneaklpnvemisldimdsqrvkkvisd
ikpdyifhlaakssvkdswlnkkgtfstnvfgtlhvldavrdsnldcriltigsseeygm
ilpeespvseenqlrpmspygvskasvgmlarqyvkaygmdiihtrtfnhigpgqslgfv
tqdfakqivdiemekqepiikvgnleavrdftdvrdivqaywllsqygktgdvynvcsgi
gtriqdvldlllamanvkidtelnplqlrpsevptligsnkrlkdstgwkpriplekslf
eilqsyrqa

SCOPe Domain Coordinates for d2pk3b_:

Click to download the PDB-style file with coordinates for d2pk3b_.
(The format of our PDB-style files is described here.)

Timeline for d2pk3b_: