Lineage for d2peza_ (2pez A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474612Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2474632Protein automated matches [226942] (4 species)
    not a true protein
  7. 2474649Species Human (Homo sapiens) [TaxId:9606] [225272] (2 PDB entries)
  8. 2474650Domain d2peza_: 2pez A: [205517]
    automated match to d1m7gd_
    complexed with dat, ggz; mutant

Details for d2peza_

PDB Entry: 2pez (more details), 1.4 Å

PDB Description: Crystal structrue of deletion mutant of APS-kinase domain of human PAPS-synthetase 1 in complex with cyclic PAPS and dADP
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)

SCOPe Domain Sequences for d2peza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peza_ c.37.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
kglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv

SCOPe Domain Coordinates for d2peza_:

Click to download the PDB-style file with coordinates for d2peza_.
(The format of our PDB-style files is described here.)

Timeline for d2peza_: