Lineage for d2pceg2 (2pce G:128-372)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344281Species Roseovarius nubinhibens [TaxId:89187] [225251] (4 PDB entries)
  8. 1344301Domain d2pceg2: 2pce G:128-372 [205508]
    Other proteins in same PDB: d2pcea1, d2pceb1, d2pcec1, d2pced1, d2pcee1, d2pcef1, d2pceg1, d2pceh1
    automated match to d1jpma1
    complexed with po4

Details for d2pceg2

PDB Entry: 2pce (more details), 2 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (G:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pceg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pceg2 c.1.11.0 (G:128-372) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla
drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld
eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf
aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt
pvktf

SCOPe Domain Coordinates for d2pceg2:

Click to download the PDB-style file with coordinates for d2pceg2.
(The format of our PDB-style files is described here.)

Timeline for d2pceg2: