SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2pceg2 (2pce G:128-372)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2087849Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries)
  8. 2087871Domain d2pceg2: 2pce G:128-372 [205508]
    Other proteins in same PDB: d2pcea1, d2pcea3, d2pceb1, d2pceb3, d2pcec1, d2pcec3, d2pced1, d2pced3, d2pcee1, d2pcee3, d2pcef1, d2pcef3, d2pceg1, d2pceg3, d2pceh1, d2pceh3
    automated match to d1jpma1
    complexed with po4

Details for d2pceg2

PDB Entry: 2pce (more details), 2 Å

PDB Description: Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM
PDB Compounds: (G:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pceg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pceg2 c.1.11.0 (G:128-372) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla
drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld
eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf
aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt
pvktf

SCOPe Domain Coordinates for d2pceg2:

Click to download the PDB-style file with coordinates for d2pceg2.
(The format of our PDB-style files is described here.)

Timeline for d2pceg2: