![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (94 species) not a true protein |
![]() | Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries) |
![]() | Domain d2pced1: 2pce D:2-127 [205501] Other proteins in same PDB: d2pcea2, d2pcea3, d2pceb2, d2pceb3, d2pcec2, d2pcec3, d2pced2, d2pced3, d2pcee2, d2pcee3, d2pcef2, d2pcef3, d2pceg2, d2pceg3, d2pceh2, d2pceh3 automated match to d1jpma2 complexed with po4 |
PDB Entry: 2pce (more details), 2 Å
SCOPe Domain Sequences for d2pced1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pced1 d.54.1.0 (D:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl cdmtgg
Timeline for d2pced1: