Lineage for d2p1ye2 (2p1y E:302-412)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759879Domain d2p1ye2: 2p1y E:302-412 [205412]
    Other proteins in same PDB: d2p1ya1, d2p1yc1, d2p1ye1, d2p1yg1
    automated match to d1bwma1

Details for d2p1ye2

PDB Entry: 2p1y (more details), 2.42 Å

PDB Description: 1.B2.D9, a bispecific alpha/beta TCR
PDB Compounds: (E:) bispecific alpha/beta TCR

SCOPe Domain Sequences for d2p1ye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p1ye2 b.1.1.0 (E:302-412) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf
tiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp

SCOPe Domain Coordinates for d2p1ye2:

Click to download the PDB-style file with coordinates for d2p1ye2.
(The format of our PDB-style files is described here.)

Timeline for d2p1ye2: