SCOPe 2.08: Domain d2p1ye1: 2p1y E:3-116

Lineage for d2p1ye1 (2p1y E:3-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2p1ye1: 2p1y E:3-116 [205411]
   Other proteins in same PDB: d2p1ya2, d2p1yc2, d2p1ye2, d2p1yg2
   automated match to d1bwma2

Details for d2p1ye1

PDB Entry: 2p1y, 2.42 Å

PDB Description: 1.B2.D9, a bispecific alpha/beta TCR

PDB Compounds: (E:) bispecific alpha/beta TCR

SCOPe Domain Sequences for d2p1ye1:

Sequence, based on SEQRES records:

>d2p1ye1 b.1.1.1 (E:3-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvl

Sequence, based on observed residues (ATOM records):

>d2p1ye1 b.1.1.1 (E:3-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvl

Timeline for d2p1ye1:

• d2p1ye1 first appeared in SCOPe 2.03
  
• d2p1ye1 appears in SCOPe 2.07