SCOPe 2.08: Domain d2p0aa1: 2p0a A:90-192

Lineage for d2p0aa1 (2p0a A:90-192)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225246] (2 PDB entries)

8. Domain d2p0aa1: 2p0a A:90-192 [205401]
   Other proteins in same PDB: d2p0aa2, d2p0ab2
   automated match to d1i7na1
   complexed with anp, cl, edo, so4

Details for d2p0aa1

PDB Entry: 2p0a, 1.9 Å

PDB Description: the crystal structure of human synapsin iii (syn3) in complex with amppnp

PDB Compounds: (A:) Synapsin-3

SCOPe Domain Sequences for d2p0aa1:

Sequence, based on SEQRES records:

>d2p0aa1 c.30.1.0 (A:90-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rprillviddahtdwskyfhgkkvngeieirveqaefselnlaayvtggcmvdmqvvrng
tkvvsrsfkpdfilvrqhaysmalgedyrslviglqygglpav

Sequence, based on observed residues (ATOM records):

>d2p0aa1 c.30.1.0 (A:90-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rprillviddahtdwskyfhgkkvngeieirveqaefselnlaayvtggcmvdmqrsfkp
dfilvrqhaysmalgedyrslviglqygglpav

Timeline for d2p0aa1:

• d2p0aa1 first appeared in SCOPe 2.03
  
• d2p0aa1 appears in SCOPe 2.07