SCOPe 2.08: Domain d2p0ab2: 2p0a B:193-397

Lineage for d2p0ab2 (2p0a B:193-397)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins)
   automatically mapped to Pfam PF02750

6. Protein automated matches [226936] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225247] (1 PDB entry)

8. Domain d2p0ab2: 2p0a B:193-397 [205404]
   Other proteins in same PDB: d2p0aa1, d2p0ab1
   automated match to d1i7la2
   complexed with anp, cl, edo, so4

Details for d2p0ab2

PDB Entry: 2p0a, 1.9 Å

PDB Description: the crystal structure of human synapsin iii (syn3) in complex with amppnp

PDB Compounds: (B:) Synapsin-3

SCOPe Domain Sequences for d2p0ab2:

Sequence; same for both SEQRES and ATOM records:

>d2p0ab2 d.142.1.3 (B:193-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslysvynfcskpwvfsqlikifhslgpekfplveqtffpnhkpmvtaphfpvvvklgha
hagmgkikvenqldfqditsvvamaktyatteafidskydiriqkigsnykaymrtsisg
nwkantgsamleqvamteryrlwvdscsemfggldicavkavhskdgrdyiievmdssmp
ligehveedrqlmadlvvskmsqlp

Timeline for d2p0ab2:

• d2p0ab2 first appeared in SCOPe 2.03
  
• d2p0ab2 appears in SCOPe 2.07