Lineage for d2p0ab2 (2p0a B:193-397)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978740Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins)
    automatically mapped to Pfam PF02750
  6. 2978764Protein automated matches [226936] (1 species)
    not a true protein
  7. 2978765Species Human (Homo sapiens) [TaxId:9606] [225247] (1 PDB entry)
  8. 2978767Domain d2p0ab2: 2p0a B:193-397 [205404]
    Other proteins in same PDB: d2p0aa1, d2p0ab1
    automated match to d1i7la2
    complexed with anp, cl, edo, so4

Details for d2p0ab2

PDB Entry: 2p0a (more details), 1.9 Å

PDB Description: the crystal structure of human synapsin iii (syn3) in complex with amppnp
PDB Compounds: (B:) Synapsin-3

SCOPe Domain Sequences for d2p0ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0ab2 d.142.1.3 (B:193-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslysvynfcskpwvfsqlikifhslgpekfplveqtffpnhkpmvtaphfpvvvklgha
hagmgkikvenqldfqditsvvamaktyatteafidskydiriqkigsnykaymrtsisg
nwkantgsamleqvamteryrlwvdscsemfggldicavkavhskdgrdyiievmdssmp
ligehveedrqlmadlvvskmsqlp

SCOPe Domain Coordinates for d2p0ab2:

Click to download the PDB-style file with coordinates for d2p0ab2.
(The format of our PDB-style files is described here.)

Timeline for d2p0ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p0ab1