Lineage for d2ox4f2 (2ox4 F:119-392)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837904Species Zymomonas mobilis [TaxId:542] [225233] (1 PDB entry)
  8. 2837910Domain d2ox4f2: 2ox4 F:119-392 [205389]
    Other proteins in same PDB: d2ox4a1, d2ox4a3, d2ox4b1, d2ox4b3, d2ox4c1, d2ox4c3, d2ox4c4, d2ox4d1, d2ox4d3, d2ox4d4, d2ox4e1, d2ox4e3, d2ox4f1, d2ox4f3, d2ox4g1, d2ox4g3, d2ox4h1, d2ox4h3
    automated match to d2gl5a1
    complexed with cl, gol, mg

Details for d2ox4f2

PDB Entry: 2ox4 (more details), 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4
PDB Compounds: (F:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox4f2 c.1.11.0 (F:119-392) automated matches {Zymomonas mobilis [TaxId: 542]}
knredlrvyasqlqfgwgkerkskgrkeeyaeealkavaegydavkvdvlahdrngsreg
vflegplpsetikigverveairnavgpdvdiivenhghtdlvsaiqfakaieefniffy
eeintplnprllkeakkkidiplasgeriysrwgflpfledrsidviqpdlgtcggftef
kkiadmahifevtvqahvagtgvaeaaslhaeiaipnfcihehhqktllpeyeelcvhny
qpvkgrykvpelpgigqditeklyqisdyvsiea

SCOPe Domain Coordinates for d2ox4f2:

Click to download the PDB-style file with coordinates for d2ox4f2.
(The format of our PDB-style files is described here.)

Timeline for d2ox4f2: