| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry) |
| Domain d2ox4c1: 2ox4 C:2-118 [205382] Other proteins in same PDB: d2ox4a2, d2ox4a3, d2ox4b2, d2ox4b3, d2ox4c2, d2ox4c3, d2ox4c4, d2ox4d2, d2ox4d3, d2ox4d4, d2ox4e2, d2ox4e3, d2ox4f2, d2ox4f3, d2ox4g2, d2ox4g3, d2ox4h2, d2ox4h3 automated match to d2gl5a2 complexed with cl, gol, mg |
PDB Entry: 2ox4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ox4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox4c1 d.54.1.0 (C:2-118) automated matches {Zymomonas mobilis [TaxId: 542]}
kitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaalli
gedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg
Timeline for d2ox4c1: