Lineage for d2ox4f1 (2ox4 F:0-118)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649789Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry)
  8. 1649795Domain d2ox4f1: 2ox4 F:0-118 [205388]
    Other proteins in same PDB: d2ox4a2, d2ox4b2, d2ox4c2, d2ox4d2, d2ox4e2, d2ox4f2, d2ox4g2, d2ox4h2
    automated match to d2gl5a2
    complexed with cl, gol, mg

Details for d2ox4f1

PDB Entry: 2ox4 (more details), 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4
PDB Compounds: (F:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox4f1 d.54.1.0 (F:0-118) automated matches {Zymomonas mobilis [TaxId: 542]}
slkitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaal
ligedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg

SCOPe Domain Coordinates for d2ox4f1:

Click to download the PDB-style file with coordinates for d2ox4f1.
(The format of our PDB-style files is described here.)

Timeline for d2ox4f1: