Lineage for d2ox4d1 (2ox4 D:2-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555592Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry)
  8. 2555596Domain d2ox4d1: 2ox4 D:2-118 [205384]
    Other proteins in same PDB: d2ox4a2, d2ox4a3, d2ox4b2, d2ox4b3, d2ox4c2, d2ox4c3, d2ox4c4, d2ox4d2, d2ox4d3, d2ox4d4, d2ox4e2, d2ox4e3, d2ox4f2, d2ox4f3, d2ox4g2, d2ox4g3, d2ox4h2, d2ox4h3
    automated match to d2gl5a2
    complexed with cl, gol, mg

Details for d2ox4d1

PDB Entry: 2ox4 (more details), 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4
PDB Compounds: (D:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox4d1 d.54.1.0 (D:2-118) automated matches {Zymomonas mobilis [TaxId: 542]}
kitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaalli
gedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg

SCOPe Domain Coordinates for d2ox4d1:

Click to download the PDB-style file with coordinates for d2ox4d1.
(The format of our PDB-style files is described here.)

Timeline for d2ox4d1: