SCOPe 2.07: Domain d2ox4d1: 2ox4 D:2-118

Lineage for d2ox4d1 (2ox4 D:2-118)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry)

8. Domain d2ox4d1: 2ox4 D:2-118 [205384]
   Other proteins in same PDB: d2ox4a2, d2ox4a3, d2ox4b2, d2ox4b3, d2ox4c2, d2ox4c3, d2ox4c4, d2ox4d2, d2ox4d3, d2ox4d4, d2ox4e2, d2ox4e3, d2ox4f2, d2ox4f3, d2ox4g2, d2ox4g3, d2ox4h2, d2ox4h3
   automated match to d2gl5a2
   complexed with cl, gol, mg

Details for d2ox4d1

PDB Entry: 2ox4, 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4

PDB Compounds: (D:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4d1:

Sequence; same for both SEQRES and ATOM records:

>d2ox4d1 d.54.1.0 (D:2-118) automated matches {Zymomonas mobilis [TaxId: 542]}
kitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaalli
gedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg

Timeline for d2ox4d1:

• d2ox4d1 first appeared in SCOPe 2.03
  
• d2ox4d1 appears in SCOPe 2.06
  
• d2ox4d1 appears in the current release, SCOPe 2.08