SCOP 1.71: Domain d1brea_: 1bre A:

Lineage for d1brea_ (1bre A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1brea_: 1bre A: [20538]

Details for d1brea_

PDB Entry: 1bre, 2 Å

PDB Description: immunoglobulin light chain protein

SCOP Domain Sequences for d1brea_:

Sequence; same for both SEQRES and ATOM records:

>d1brea_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

Timeline for d1brea_:

• d1brea_ first appeared (with stable ids) in SCOP 1.55
  
• d1brea_ appears in SCOP 1.69
  
• d1brea_ appears in SCOP 1.73
  
• d1brea_ appears in the current release, SCOPe 2.08