SCOPe 2.08: Domain d2os0a1: 2os0 A:1-187

Lineage for d2os0a1 (2os0 A:1-187)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Enterococcus faecalis [TaxId:1351] [225419] (2 PDB entries)

8. Domain d2os0a1: 2os0 A:1-187 [205356]
   Other proteins in same PDB: d2os0a2
   automated match to d1vezb_
   complexed with ni, so4

Details for d2os0a1

PDB Entry: 2os0, 1.3 Å

PDB Description: structures of actinonin bound peptide deformylases from e. faecalis and s. pyogenes

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2os0a1:

Sequence, based on SEQRES records:

>d2os0a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]}
mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrgdvg
laapqldiskriiavhvpsndpenetpslstvmynpkilshsvqdvclgegegclsvdrd
vpgyvvrhnkitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalk
egvlvie

Sequence, based on observed residues (ATOM records):

>d2os0a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]}
mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrgdvg
laapqldiskriiavhvpslstvmynpkilshsvqdvclgegegclsvdrdvpgyvvrhn
kitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalkegvlvie

Timeline for d2os0a1:

• d2os0a1 first appeared in SCOPe 2.03, called d2os0a_
  
• d2os0a1 appears in SCOPe 2.07