![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein Peptide deformylase [56422] (11 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [225419] (2 PDB entries) |
![]() | Domain d2os0a1: 2os0 A:1-187 [205356] Other proteins in same PDB: d2os0a2 automated match to d1vezb_ complexed with ni, so4 |
PDB Entry: 2os0 (more details), 1.3 Å
SCOPe Domain Sequences for d2os0a1:
Sequence, based on SEQRES records: (download)
>d2os0a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]} mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrgdvg laapqldiskriiavhvpsndpenetpslstvmynpkilshsvqdvclgegegclsvdrd vpgyvvrhnkitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalk egvlvie
>d2os0a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]} mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrgdvg laapqldiskriiavhvpslstvmynpkilshsvqdvclgegegclsvdrdvpgyvvrhn kitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalkegvlvie
Timeline for d2os0a1: