SCOPe 2.08: Domain d3bjlb1: 3bjl B:1-111

Lineage for d3bjlb1 (3bjl B:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d3bjlb1: 3bjl B:1-111 [20527]
   Other proteins in same PDB: d3bjla2, d3bjlb2
   VL dimer of Bence-Jones protein LOC

Details for d3bjlb1

PDB Entry: 3bjl, 2.3 Å

PDB Description: loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate

PDB Compounds: (B:) loc - lambda 1 type light-chain dimer

SCOPe Domain Sequences for d3bjlb1:

Sequence; same for both SEQRES and ATOM records:

>d3bjlb1 b.1.1.1 (B:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

Timeline for d3bjlb1:

• d3bjlb1 first appeared (with stable ids) in SCOP 1.55
  
• d3bjlb1 appears in SCOPe 2.07