PDB entry 3bjl

View 3bjl on RCSB PDB site
Description: loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate
Class: immunoglobulin
Keywords: bence jones, antibody, multiple quaternary structures, immunoglobulin
Deposited on 1995-05-26, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.165
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: loc - lambda 1 type light-chain dimer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S25754 (1-215)
      • conflict (18)
      • conflict (30)
      • conflict (32)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (42)
      • conflict (49-51)
      • conflict (53)
      • conflict (55)
      • conflict (59)
      • conflict (64)
      • conflict (80)
      • conflict (84)
      • conflict (96-98)
    Domains in SCOPe 2.07: d3bjla1, d3bjla2
  • Chain 'B':
    Compound: loc - lambda 1 type light-chain dimer
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S25754 (1-215)
      • conflict (18)
      • conflict (30)
      • conflict (32)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (42)
      • conflict (49-51)
      • conflict (53)
      • conflict (55)
      • conflict (59)
      • conflict (64)
      • conflict (80)
      • conflict (84)
      • conflict (96-98)
    Domains in SCOPe 2.07: d3bjlb1, d3bjlb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bjlA (A:)
    esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bjlB (B:)
    esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs