Lineage for d2o72a2 (2o72 A:102-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768952Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)
  8. 1768962Domain d2o72a2: 2o72 A:102-213 [205236]
    automated match to d1ncja2
    complexed with ca

Details for d2o72a2

PDB Entry: 2o72 (more details), 2 Å

PDB Description: crystal structure analysis of human e-cadherin (1-213)
PDB Compounds: (A:) epithelial-cadherin

SCOPe Domain Sequences for d2o72a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o72a2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd

SCOPe Domain Coordinates for d2o72a2:

Click to download the PDB-style file with coordinates for d2o72a2.
(The format of our PDB-style files is described here.)

Timeline for d2o72a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o72a1