Lineage for d2o72a2 (2o72 A:102-213)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (4 families) 
Family b.1.6.1: Cadherin [49314] (4 proteins) Protein E-cadherin (epithelial) [49317] (2 species)
synonym: uvomorulin
Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries) 
Domain d2o72a2: 2o72 A:102-213 [205236]
automated match to d1ncja2
complexed with ca
Details for d2o72a2
PDB Entry: 2o72 (more details), 2 Å
PDB Description: crystal structure analysis of human e-cadherin (1-213)
PDB Compounds: (A:) epithelial-cadherinSCOPe Domain Sequences for d2o72a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o72a2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd
SCOPe Domain Coordinates for d2o72a2:
Click to download the PDB-style file with coordinates for d2o72a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o72a2:
- d2o72a2 first appeared in SCOPe 2.03
- d2o72a2 appears in SCOPe 2.07
View in 3D
