Lineage for d2noxh_ (2nox H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351564Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2351565Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2351705Family a.266.1.0: automated matches [227197] (1 protein)
    not a true family
  6. 2351706Protein automated matches [226924] (2 species)
    not a true protein
  7. 2351707Species Cupriavidus metallidurans [TaxId:119219] [225197] (1 PDB entry)
  8. 2351715Domain d2noxh_: 2nox H: [205136]
    automated match to d2nw8a1
    complexed with hem

Details for d2noxh_

PDB Entry: 2nox (more details), 2.4 Å

PDB Description: crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans
PDB Compounds: (H:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d2noxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2noxh_ a.266.1.0 (H:) automated matches {Cupriavidus metallidurans [TaxId: 119219]}
msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
rrmldvvlfpelwklrtdl

SCOPe Domain Coordinates for d2noxh_:

Click to download the PDB-style file with coordinates for d2noxh_.
(The format of our PDB-style files is described here.)

Timeline for d2noxh_: