Lineage for d2jkvf1 (2jkv F:2-177)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107886Domain d2jkvf1: 2jkv F:2-177 [205103]
    Other proteins in same PDB: d2jkva2, d2jkvb2, d2jkvc2, d2jkvd2, d2jkve2, d2jkvf2
    automated match to d1pgja2
    complexed with cl, nap, so4

Details for d2jkvf1

PDB Entry: 2jkv (more details), 2.53 Å

PDB Description: structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
PDB Compounds: (F:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2jkvf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkvf1 c.2.1.0 (F:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde

SCOPe Domain Coordinates for d2jkvf1:

Click to download the PDB-style file with coordinates for d2jkvf1.
(The format of our PDB-style files is described here.)

Timeline for d2jkvf1: