SCOPe 2.07: Domain d2jexa_: 2jex A:

Lineage for d2jexa_ (2jex A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
   complex fold made of bifurcated and coiled beta-sheets

4. Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families)
   automatically mapped to Pfam PF00508

5. Family b.91.1.0: automated matches [227208] (1 protein)
   not a true family

6. Protein automated matches [226941] (1 species)
   not a true protein

7. Species Bovine papillomavirus type 1 [TaxId:10559] [225265] (2 PDB entries)

8. Domain d2jexa_: 2jex A: [205019]
   automated match to d1tueg_

Details for d2jexa_

PDB Entry: 2jex, 2.35 Å

PDB Description: transcription activator structure reveals redox control of a replication initiation reaction

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2jexa_:

Sequence; same for both SEQRES and ATOM records:

>d2jexa_ b.91.1.0 (A:) automated matches {Bovine papillomavirus type 1 [TaxId: 10559]}
tacerlhvaqetqmqliekssdklqdhilywtavrtentllyaarkkgvtvlghcrvphs
vvcqerakqaiemqlslqelsktefgdepwslldtswdrymsepkrcfkkgarvvevefd
gnasntnwytvysnlymrtedgwqlakagadgtglyyctmagagriyysafgdeaarfst
tghysvrdqdrvyagvs

Timeline for d2jexa_:

• d2jexa_ first appeared in SCOPe 2.03
  
• d2jexa_ appears in SCOPe 2.06
  
• d2jexa_ appears in the current release, SCOPe 2.08