Lineage for d2jc7a_ (2jc7 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1950340Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1950341Protein automated matches [190857] (31 species)
    not a true protein
  7. 1950342Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries)
  8. 1950371Domain d2jc7a_: 2jc7 A: [205014]
    automated match to d1k38a_
    complexed with so4

Details for d2jc7a_

PDB Entry: 2jc7 (more details), 2.5 Å

PDB Description: the crystal structure of the carbapenemase oxa-24 reveals new insights into the mechanism of carbapenem-hydrolysis
PDB Compounds: (A:) beta-lactamase oxa-24

SCOPe Domain Sequences for d2jc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jc7a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

SCOPe Domain Coordinates for d2jc7a_:

Click to download the PDB-style file with coordinates for d2jc7a_.
(The format of our PDB-style files is described here.)

Timeline for d2jc7a_: