SCOPe 2.06: Domain d2jc2b_: 2jc2 B:

Lineage for d2jc2b_ (2jc2 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein automated matches [226948] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225306] (1 PDB entry)

8. Domain d2jc2b_: 2jc2 B: [205010]
   automated match to d1juoa_
   complexed with so4; mutant

Details for d2jc2b_

PDB Entry: 2jc2, 2.5 Å

PDB Description: the crystal structure of the natural f112l human sorcin mutant

PDB Compounds: (B:) sorcin

SCOPe Domain Sequences for d2jc2b_:

Sequence; same for both SEQRES and ATOM records:

>d2jc2b_ a.39.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv

Timeline for d2jc2b_:

• d2jc2b_ first appeared in SCOPe 2.03
  
• d2jc2b_ appears in SCOPe 2.05
  
• d2jc2b_ appears in SCOPe 2.07
  
• d2jc2b_ appears in the current release, SCOPe 2.08