Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries) |
Domain d2j9ca1: 2j9c A:-1-112 [204983] Other proteins in same PDB: d2j9ca2, d2j9cb2, d2j9cc2 automated match to d3ncrc_ complexed with act, atp, cl, edo, mg |
PDB Entry: 2j9c (more details), 1.3 Å
SCOPe Domain Sequences for d2j9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ca1 d.58.5.0 (A:-1-112) automated matches {Methanococcus jannaschii [TaxId: 2190]} gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal
Timeline for d2j9ca1:
View in 3D Domains from other chains: (mouse over for more information) d2j9cb1, d2j9cb2, d2j9cc1, d2j9cc2 |