Lineage for d2j5ib_ (2j5i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854216Species Pseudomonas fluorescens [TaxId:294] [225188] (3 PDB entries)
  8. 2854218Domain d2j5ib_: 2j5i B: [204943]
    automated match to d3peaf_

Details for d2j5ib_

PDB Entry: 2j5i (more details), 1.8 Å

PDB Description: crystal structure of hydroxycinnamoyl-coa hydratase-lyase
PDB Compounds: (B:) p-hydroxycinnamoyl coa hydratase/lyase

SCOPe Domain Sequences for d2j5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5ib_ c.14.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
grwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgagea
wtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfspl
vacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaaem
glvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldqs
rlldt

SCOPe Domain Coordinates for d2j5ib_:

Click to download the PDB-style file with coordinates for d2j5ib_.
(The format of our PDB-style files is described here.)

Timeline for d2j5ib_: