PDB entry 2j5i

View 2j5i on RCSB PDB site
Description: crystal structure of hydroxycinnamoyl-coa hydratase-lyase
Class: lyase
Keywords: lyase, vanillin, aldolase, crotonase, hydratase, coenzyme-a
Deposited on 2006-09-18, released 2006-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69762
      • conflict (168)
      • conflict (231)
    Domains in SCOPe 2.07: d2j5ia_
  • Chain 'B':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ib_
  • Chain 'C':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ic_
  • Chain 'D':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5id_
  • Chain 'E':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ie_
  • Chain 'F':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5if_
  • Chain 'G':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ig_
  • Chain 'H':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ih_
  • Chain 'I':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ii_
  • Chain 'J':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ij_
  • Chain 'K':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5ik_
  • Chain 'L':
    Compound: p-hydroxycinnamoyl coa hydratase/lyase
    Species: PSEUDOMONAS FLUORESCENS [TaxId:294]
    Domains in SCOPe 2.07: d2j5il_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5iA (A:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslmyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iA (A:)
    tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
    geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
    splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslmyimtgktfggqka
    aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
    dqsrlldt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5iB (B:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iB (B:)
    grwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgagea
    wtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfspl
    vacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaaem
    glvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakldqs
    rlldt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j5iC (C:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iC (C:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j5iD (D:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iD (D:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlldte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j5iE (E:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iE (E:)
    tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
    geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
    splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka
    aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
    dqsrlldt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j5iF (F:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iF (F:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j5iG (G:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iG (G:)
    tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
    geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
    splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka
    aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
    dqsrll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j5iH (H:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iH (H:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlldt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j5iI (I:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltwqqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iI (I:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltwqqnedylyakld
    qsrlld
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j5iJ (J:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iJ (J:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlldt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2j5iK (K:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iK (K:)
    tyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltga
    geawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggf
    splvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqka
    aemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakl
    dqsrlld
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j5iL (L:)
    mstyegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvlt
    gageawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgg
    gfsplvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggq
    kaaemglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylya
    kldqsrlldteggreqgmkqflddksikpglqaykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5iL (L:)
    yegrwktvkveiedgiafvilnrpekrnamsptlnremidvletleqdpaagvlvltgag
    eawtagmdlkeyfrevdagpeilqekirreasqwqwkllrmyakptiamvngwcfgggfs
    plvacdlaicadeatfglseinwgippgnlvskamadtvghrqslyyimtgktfggqkaa
    emglvnesvplaqlrevtielarnlleknpvvlraakhgfkrcreltweqnedylyakld
    qsrlld