SCOP 1.71: Domain d1dzbb2: 1dzb B:201-307

Lineage for d1dzbb2 (1dzb B:201-307)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1dzbb2: 1dzb B:201-307 [20491]
   Other proteins in same PDB: d1dzba1, d1dzbb1, d1dzbx_, d1dzby_
   part of anti-lysozyme scFv 1F9

Details for d1dzbb2

PDB Entry: 1dzb, 2 Å

PDB Description: crystal structure of phage library-derived single-chain fv fragment 1f9 in complex with turkey egg-white lysozyme

SCOP Domain Sequences for d1dzbb2:

Sequence; same for both SEQRES and ATOM records:

>d1dzbb2 b.1.1.1 (B:201-307) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqspssmytslgervtitckasqdinsylrwfqqkpgkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtttyyclqhgespytfgggtkleik

Timeline for d1dzbb2:

• d1dzbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dzbb2 appears in SCOP 1.69
  
• d1dzbb2 appears in SCOP 1.73
  
• d1dzbb2 appears in the current release, SCOPe 2.08