Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [225210] (4 PDB entries) |
Domain d2iz0c1: 2iz0 C:2-177 [204904] Other proteins in same PDB: d2iz0a2, d2iz0b2, d2iz0b3, d2iz0c2 automated match to d1pgja2 complexed with atr, cl, edo, gol, nap, p33, peg, res |
PDB Entry: 2iz0 (more details), 2.6 Å
SCOPe Domain Sequences for d2iz0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iz0c1 c.2.1.0 (C:2-177) automated matches {Lactococcus lactis [TaxId: 1358]} aqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleefv gslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgin figtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgan
Timeline for d2iz0c1: