Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (23 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [225211] (4 PDB entries) |
Domain d2iypc2: 2iyp C:178-470 [204899] Other proteins in same PDB: d2iypa1, d2iypb1, d2iypc1 automated match to d1pgja1 complexed with 5rp, a2p, nap |
PDB Entry: 2iyp (more details), 2.79 Å
SCOPe Domain Sequences for d2iypc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iypc2 a.100.1.0 (C:178-470) automated matches {Lactococcus lactis [TaxId: 1358]} gaghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitk evlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykde rvkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygt iaqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqag tpiptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
Timeline for d2iypc2:
View in 3D Domains from other chains: (mouse over for more information) d2iypa1, d2iypa2, d2iypb1, d2iypb2 |