Lineage for d2ijxd2 (2ijx D:127-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977489Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)
  8. 2977497Domain d2ijxd2: 2ijx D:127-244 [204803]
    automated match to d1ud9a2
    complexed with edo

Details for d2ijxd2

PDB Entry: 2ijx (more details), 1.9 Å

PDB Description: Crystal structure of PCNA3 monomer from Sulfolobus solfataricus.
PDB Compounds: (D:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d2ijxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijxd2 d.131.1.0 (D:127-244) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
qfdisatissdgfksaisevstvtdnvvveghedrilikaegesevevefskdtgglqdl
efskesknsysaeylddvlsltklsdyvkisfgnqkplqlffnmegggkvtyllapkv

SCOPe Domain Coordinates for d2ijxd2:

Click to download the PDB-style file with coordinates for d2ijxd2.
(The format of our PDB-style files is described here.)

Timeline for d2ijxd2: