SCOPe 2.08: Domain d2i1ya_: 2i1y A:

Lineage for d2i1ya_ (2i1y A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d2i1ya_: 2i1y A: [204684]
   automated match to d1oesa_
   complexed with gol

Details for d2i1ya_

PDB Entry: 2i1y, 2.23 Å

PDB Description: crystal structure of the phosphatase domain of human ptp ia-2

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase

SCOPe Domain Sequences for d2i1ya_:

Sequence; same for both SEQRES and ATOM records:

>d2i1ya_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tghmilaymedhlrnrdrlakewqalcayqaepntcataqgegnikknrhpdflpydhar
iklkvesspsrsdyinaspiiehdprmpayiatqgplshtiadfwqmvwesgctvivmlt
plvedgvkqcdrywpdegaslyhvyevnlvsehiwcedflvrsfylknvqtqetrtltqf
hflswpaegtpastrplldfrrkvnkcyrgrscpiivhcsdgagrtgtyilidmvlnrma
kgvkeidiaatlehvrdqrpglvrskdqfefaltavaeevnailkal

Timeline for d2i1ya_:

• d2i1ya_ first appeared in SCOPe 2.03
  
• d2i1ya_ appears in SCOPe 2.07